PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN24649.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 316aa    MW: 35653.5 Da    PI: 8.9662
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN24649.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++lv +v+++G g+W++++ + g+ R++k+c++rw +yl
       KHN24649.1 14 KGLWTPEEDKKLVAYVEKHGHGNWRSVPDKAGLERCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding49.31.2e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eEd  +++++++lG++ W+ Ia++++ +Rt++++k++w++
       KHN24649.1  67 RGNFSMEEDHTIIQLHALLGNK-WSIIAAHLP-RRTDNEIKNYWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-26564IPR009057Homeodomain-like
PROSITE profilePS5129425.331965IPR017930Myb domain
SuperFamilySSF466892.16E-3211108IPR009057Homeodomain-like
SMARTSM007172.0E-151363IPR001005SANT/Myb domain
PfamPF002491.6E-171461IPR001005SANT/Myb domain
CDDcd001678.78E-131761No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2565117IPR009057Homeodomain-like
PROSITE profilePS5129420.05566116IPR017930Myb domain
SMARTSM007173.3E-1366114IPR001005SANT/Myb domain
PfamPF002491.0E-1467110IPR001005SANT/Myb domain
CDDcd001674.80E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGRMPCCEKG GLKKGLWTPE EDKKLVAYVE KHGHGNWRSV PDKAGLERCG KSCRLRWINY  60
LKPDIKRGNF SMEEDHTIIQ LHALLGNKWS IIAAHLPRRT DNEIKNYWNT NVKKRLIRMG  120
LDPVTHKPIK PNTFERYGGG HGQFKNTINT NHVAQWESAR MEAEARGSVL QVGSHSSHQP  180
QLVLSKIPTQ PCPSSSDSVS TKHNTVYNMY ALVLATNHDP LWPVSPLSIP GWKVPAVSTN  240
VGQFTNTGSS LSYESDVNVT ETNSQIQKIP ENYLSNLQDE DIMVAVEAFR TIRCESILEL  300
FRGSNDMEGL NKQSFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150438e-50AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003517808.10.0PREDICTED: transcription repressor MYB5-like
TrEMBLA0A0B2QX790.0A0A0B2QX79_GLYSO; Transcription factor MYB28
STRINGGLYMA01G06192.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13536826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.14e-85myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]